Genetic Sequence Data Bank
                         April 15 2003

               NCBI-GenBank Flat File Release 135.0

                    Distribution Release Notes

 24027936 loci, 31099264455 bases, from 24027936 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank database. If you have any questions or
comments about GenBank or this document, please contact NCBI via email
at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 135.0
1.2 Cutoff Date
1.3 Important Changes in Release 135.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics
     2.2.7 Selected Per-Organism Statistics
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 135.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://www.ncbi.nlm.nih.gov/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 135.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server: ftp.ncbi.nih.gov .

1.2 Cutoff Date

  This full release, 135.0, incorporates data available to the collaborating
databases as of April 9, 2003.  For more recent data, users are advised to:

  o Download the GenBank Update files by anonymous FTP to 'ftp.ncbi.nih.gov':

     ftp://ftp.ncbi.nih.gov/ncbi-asn1 (ASN.1 format)
     ftp://ftp.ncbi.nih.gov/genbank   (flatfile format)

    Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
    Supercomputer Center and the University of Indiana:

     ftp://genbank.sdsc.edu/pub
     ftp://bio-mirror.net/biomirror/genbank/

    Some users who experience slow FTP transfers of large files (entire releases,
    the GenBank Cumulative Update, etc) might realize an improvement in transfer
    rates from these alternate sites when traffic at the NCBI is high.

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 135.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 17 with this release:

  - the BCT division is now comprised of 7 files   (+1)
  - the EST division is now comprised of 244 files (+4)
  - the GSS division is now comprised of 70 files  (+4)
  - the HTG division is now comprised of 62 files  (+4)
  - the INV division is now comprised of 6 files   (+1)
  - the PAT division is now comprised of 8 files   (+1)
  - the PRI division is now comprised of 25 files  (+1)
  - the ROD division is now comprised of 7 files   (+1)

1.3.2 New /mol_type qualifier

  As of the April 2003 GenBank Release (135.0), a new source feature
  qualifier called /mol_type will begin to be used for source features.

  This qualifier will be used to indicate the in-vivo biological state
  of the sequence presented in a database record.

  The preliminary definition for /segment is :
        Qualifier       /mol_type=
        Definition      in vivo molecule type 
        Value format    "text"
        Example         /mol_type="genomic DNA",

        Comment         text limited to "genomic DNA", "genomic RNA", "mRNA" (incl EST),
                        "tRNA", "rRNA", "snoRNA", "snRNA", "scRNA", "pre-mRNA",       
                        "other RNA" (incl. synthetic), "other DNA" (incl. synthetic),
                        "unassigned DNA" (incl. unknown),"unassigned RNA" (incl. unknown)

  In-vivo molecule type information is already presented on the LOCUS
  line of the GenBank flatfile format. However, introducing /mol_type
  in the Feature Table will make the exchange of this information among
  DDBJ, EMBL, and GenBank more complete and accurate.

  NOTE: /mol_type will eventually be a mandatory qualifier for the source
  feature, probably by June 2003.

1.3.3 New /segment qualifier

  As of the April 2003 GenBank Release (135.0), a new source feature
  qualifier called /segment will begin to be used for source features.

  In the absence of a more suitable way to annotate viral segments, this
  information had either not been included in database entries, or had been
  annotated incorrectly (e.g. using /chromosome, /map etc). This new
  qualifier addresses that lack.

  The preliminary definition for /segment is :

        Qualifier       /segment=   
        Definition      name of viral or phage segment sequenced
        Value format    "text"
        Example         /segment="6"

1.3.4 New /locus_tag qualifier

  As of the April 2003 GenBank Release (135.0), a new source feature
  qualifier called /locus_tag will begin to be used.

  Many complete-genome sequencing projects use solely computational
  methods to predict coding regions and genes. The /locus_tag qualifier
  provides a method for identifying and tracking the results of such
  computations, without utilizing existing qualifiers such as /gene .

  These 'locus tags' are systematically assigned, and do not necessarily
  reflect gene name/symbol conventions in experimental literature. Hence
  the introduction of this new qualifier.

  The preliminary definition for /locus_tag is :

        Qualifier:      /locus_tag
        Definition:     feature tag assigned for tracking purposes
        Value Format:   "text" (single token)
        Example:        /locus_tag="RSc0382"
                        /locus_tag="YPO0002"
        Comment:        /locus_tag can be used with any feature where /gene
                       is valid;

1.3.5 GSS File Header Problem

  GSS sequences at GenBank are maintained in one of two different systems,
depending on their origin. One recent change to release processing involves
the parallelization of the dumps from those systems. Because the second dump
(for example) has no prior knowledge of exactly how many GSS files will be
dumped from the first, it doesn't know how to number it's own output files.

  There is thus a discrepancy between the filenames and file headers of nine
GSS flatfiles in Release 135.0. Consider the gbgss60.seq file:

GBGSS1.SEQ           Genetic Sequence Data Bank
                           April 15 2003

                NCBI-GenBank Flat File Release 135.0

                           GSS Sequences (Part 1)

   86691 loci,    65546719 bases, from    86691 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "60" based on the files dumped from the other system.

  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.


1.4 Upcoming Changes

  No changes to the format of GenBank releases are currently scheduled.


1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the databaseas
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

     ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:  

     http://www.ncbi.nlm.nih.gov/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI. 

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 481 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

1.  gbrel.txt  - Release notes (this document).
2.  gbsdr.txt - Short directory of the data bank.
3.  gbacc.idx - Index of the entries according to accession number.
4.  gbkey.idx - Index of the entries according to keyword phrase.
5.  gbaut1.idx - Index of the entries according to author, part 1.
6.  gbaut2.idx - Index of the entries according to author, part 2.
7.  gbaut3.idx - Index of the entries according to author, part 3.
8.  gbaut4.idx - Index of the entries according to author, part 4.
9.  gbaut5.idx - Index of the entries according to author, part 5.
10. gbaut6.idx - Index of the entries according to author, part 6.
11. gbaut7.idx - Index of the entries according to author, part 7.
12. gbaut8.idx - Index of the entries according to author, part 8.
13. gbaut9.idx - Index of the entries according to author, part 9.
14. gbaut10.idx - Index of the entries according to author, part 10.
15. gbaut11.idx - Index of the entries according to author, part 11.
16. gbaut12.idx - Index of the entries according to author, part 12.
17. gbaut13.idx - Index of the entries according to author, part 13.
18. gbaut14.idx - Index of the entries according to author, part 14.
19. gbaut15.idx - Index of the entries according to author, part 15.
20. gbaut16.idx - Index of the entries according to author, part 16.
21. gbaut17.idx - Index of the entries according to author, part 17.
22. gbaut18.idx - Index of the entriesaccording to author, part 18.
23. gbaut19.idx - Index of the entries according to author, part 19.
24. gbjou.idx - Index of the entries according to journal citation.
25. gbgen.idx - Index of the entries according to gene names.
26. gbsec.idx  - Index of the entries according to secondary accession number.
27. gbpri1.seq - Primate sequence entries, part 1.
28. gbpri2.seq - Primate sequence entries, part 2.
29. gbpri3.seq - Primate sequence entries, part 3.
30. gbpri4.seq - Primate sequence entries, part 4.
31. gbpri5.seq - Primate sequence entries, part 5.
32. gbpri6.seq - Primate sequence entries, part 6.
33. gbpri7.seq - Primate sequence entries, part 7.
34. gbpri8.seq - Primate sequence entries, part 8.
35. gbpri9.seq - Primate sequence entries, part 9.
36. gbpri10.seq - Primate sequence entries, part 10.
37. gbpri11.seq - Primate sequence entries, part 11.
38. gbpri12.seq - Primate sequence entries, part 12.
39. gbpri13.seq - Primate sequence entries, part 13.
40. gbpri14.seq - Primate sequence entries, part 14.
41. gbpri15.seq - Primate sequence entries, part 15.
42. gbpri16.seq - Primate sequence entries, part 16.
43. gbpri17.seq - Primate sequence entries, part 17.
44. gbpri18.seq - Primate sequence entries, part 18.
45. gbpri19.seq - Primate sequence entries, part 19.
46. gbpri20.seq - Primate sequence entries, part 20.
47. gbpri21.seq - Primate sequence entries, part 21.
48. gbpri22.seq - Primate sequence entries, part 22.
49. gbpri23.seq - Primate sequence entries, part 23.
50. gbpri24.seq - Primate sequence entries, part 24.
51. gbpri25.seq - Primate sequence entries, part 25.
52. gbrod1.seq - Rodent sequence entries, part 1.
53. gbrod2.seq - Rodent sequence entries, part 2.
54. gbrod3.seq - Rodent sequence entries, part 3.
55. gbrod4.seq - Rodent sequence entries, part 4.
56. gbrod5.seq - Rodent sequence entries, part 5.
57. gbrod6.seq - Rodent sequence entries, part 6.
58. gbrod7.seq - Rodent sequence entries, part 7.
59. gbmam.seq - Other mammalian sequence entries.
60. gbvrt1.seq - Other vertebrate sequence entries, part 1.
61. gbvrt2.seq - Other vertebrate sequence entries, part 2.
62. gbinv1.seq - Invertebrate sequence entries, part 1.
63. gbinv2.seq - Invertebrate sequence entries, part 2.
64. gbinv3.seq - Invertebrate sequence entries, part 3.
65. gbinv4.seq - Invertebrate sequence entries, part 4.
66. gbinv5.seq - Invertebrate sequence entries, part 5.
67. gbinv6.seq - Invertebrate sequence entries, part 6.
68. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
69. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
70. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
71. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
72. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
73. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
74. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
75. gbbct1.seq - Bacterial sequence entries, part 1.
76. gbbct2.seq - Bacterial sequence entries, part 2.
77. gbbct3.seq - Bacterial sequence entries, part 3.
78. gbbct4.seq - Bacterial sequence entries, part 4.
79. gbbct5.seq - Bacterial sequence entries, part 5.
80. gbbct6.seq - Bacterial sequence entries, part 6.
81. gbbct7.seq - Bacterial sequence entries, part 7.
82. gbvrl1.seq - Viral sequence entries, part 1.
83. gbvrl2.seq - Viral sequence entries, part 2.
84. gbvrl3.seq - Viral sequence entries, part 3.
85. gbphg.seq - Phage sequence entries.
86. gbsyn.seq - Synthetic and chimeric sequence entries.
87. gbuna.seq - Unannotated sequence entries.
88. gbest1.seq  - EST (expressed sequence tag) sequence entries, part 1.
89. gbest2.seq  - EST (expressed sequence tag) sequence entries, part 2.
90. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
91. gbest4.seq  - EST (expressed sequence tag) sequence entries, part 4.
92. gbest5.seq  - EST (expressed sequence tag) sequence entries, part 5.
93. gbest6.seq  - EST (expressed sequence tag) sequence entries, part 6.
94. gbest7.seq  - EST (expressed sequence tag) sequence entries, part 7.
95. gbest8.seq  - EST (expressed sequence tag) sequence entries, part 8.
96. gbest9.seq  - EST (expressed sequence tag) sequence entries, part 9.
97. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
98. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
99. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
100. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
101. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
102. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
103. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
104. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
105. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
106. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
107. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
108. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
109. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
110. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
111. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
112. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
113. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
114. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
115. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
116. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
117. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
118. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
119. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
120. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
121. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
122. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
123. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
124. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
125. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
126. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
127. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
128. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
129. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
130. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
131. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
132. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
133. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
134. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
135. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
136. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
137. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
138. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
139. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
140. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
141. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
142. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
143. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
144. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
145. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
146. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
147. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
148. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
149. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
150. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
151. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
152. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
153. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
154. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
155. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
156. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
157. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
158. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
159. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
160. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
161. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
162. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
163. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
164.gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
165. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
166. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
167. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
168. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
169. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
170. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
171. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
172. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
173. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
174. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
175. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
176. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89
177. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
178. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
179. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
180. gbest93.seq -EST (expressed sequence tag) sequence entries, part 93.
181. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
182. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
183. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
184. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
185. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
186. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
187. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
188. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
189. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
190. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
191. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
192. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
193. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
194. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
195. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
196. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
197. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
198. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
199. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
200. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
201. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
202. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
203. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
204. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
205. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
206. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
207. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
208. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
209. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
210. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
211. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
212. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
213. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
214. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
215. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
216. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
217. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
218. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
219. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
220. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
221. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
222. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
223. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
224. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
225. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
226. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
227. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
228. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
229. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
230. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
231. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
232. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
233. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
234. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
235. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
236. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
237. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
238. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
239. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
240. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
241. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
242. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
243. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
244. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
245. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
246. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
247. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
248. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
249. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
250. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
251. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
252. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
253. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
254. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
255. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
256. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
257. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
258. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
259. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
260. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
261. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
262. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
263. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
264. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
265. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
266. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
267. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
268. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
269. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
270. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
271. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
272.gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
273. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
274. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
275. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
276. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
277. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
278. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
279. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
280. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
281. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
282. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
283. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
284. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
285. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
286. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
287. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
288. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
289. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
290. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
291. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
292. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
293. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
294. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
295. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
296. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
297. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
298. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
299. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
300. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
301. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
302. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
303. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
304. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
305. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
306. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
307. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
308. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
309. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
310. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
311. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
312. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
313. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
314. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
315. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
316. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
317. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
318. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
319. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
320. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
321. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
322. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
323. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
324. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
325. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
326. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
327. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
328. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
329. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
330. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
331. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
332. gbpat1.seq  - Patent sequence entries, part 1.
333. gbpat2.seq  - Patent sequence entries, part 2.
334. gbpat3.seq  - Patent sequence entries, part 3.
335. gbpat4.seq  - Patent sequence entries, part 4.
336. gbpat5.seq  - Patent sequence entries, part 5.
337. gbpat6.seq  - Patent sequence entries, part 6.
338. gbpat7.seq  - Patent sequence entries, part 7.
339. gbpat8.seq  - Patent sequence entries, part 8.
340. gbsts1.seq  - STS (sequence tagged site) sequence entries, part 1.
341. gbsts2.seq  - STS (sequence tagged site) sequence entries, part 2.
342. gbgss1.seq  - GSS (genome survey sequence) sequence entries, part 1.
343. gbgss2.seq  - GSS (genome survey sequence) sequence entries, part 2.
344. gbgss3.seq  - GSS (genome survey sequence) sequence entries, part 3.
345. gbgss4.seq  - GSS (genome survey sequence) sequence entries, part 4.
346. gbgss5.seq  - GSS (genome survey sequence) sequence entries, part 5.
347. gbgss6.seq  - GSS (genome survey sequence) sequence entries, part 6.
348.gbgss7.seq  - GSS (genome survey sequence) sequence entries, part 7.
349. gbgss8.seq  - GSS (genome survey sequence) sequence entries, part 8.
350. gbgss9.seq  - GSS (genome survey sequence) sequence entries, part 9.
351. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
352. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
353. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
354. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
355. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
356. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
357. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
358. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
359. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
360. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
361. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
362. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
363. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
364. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
365. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
366. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
367. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
368. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
369. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
370. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
371. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
372. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
373. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
374. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
375. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
376. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
377. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
378. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
379. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
380. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
381. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
382. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
383. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
384. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
385. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
386. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
387. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
388. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
389. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
390. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
391. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
392. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
393. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
394. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
395. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
396. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
397.gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
398. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
399. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
400. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
401. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
402. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
403. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
404. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
405. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
406. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
407. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
408. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
409. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
410. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
411. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
412. gbhtg1.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 1.
413. gbhtg2.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 2.
414. gbhtg3.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 3.
415. gbhtg4.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 4.
416. gbhtg5.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 5.
417. gbhtg6.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 6.
418. gbhtg7.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 7.
419. gbhtg8.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 8.
420. gbhtg9.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 9.
421. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
422. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
423. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
424. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
425. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
426. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
427. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
428. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
429. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
430. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
431. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
432. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
433. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
434. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
435. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
436. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
437. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
438. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
439. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
440. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
441. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
442. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
443. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
444. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
445. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
446. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
447. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
448. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
449. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
450. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
451. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
452. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
453. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
454. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
455. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
456. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
457. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
458. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
459. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
460. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
461. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
462. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
463. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
464. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
465. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
466. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
467. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
468. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
469. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
470. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
471. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
472. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
473. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
474. gbhtc1.seq - HTC (high throughput cDNA sequencing) entries, part 1.
475. gbhtc2.seq - HTC (high throughput cDNA sequencing) entries, part 2.
476. gbhtc3.seq - HTC (high throughput cDNA sequencing) entries, part 3.
477. gbhtc4.seq - HTC (high throughput cDNA sequencing) entries, part 4.
478. gbcon.seq - CON division entries (see description below for details)
479. gbchg.txt   - Accession numbers of entries updated since the previous release.
480. gbdel.txt   - Accession numbers of entries deleted since the previous release.
481. gbnew.txt   - Accession numbers of entriesnew since the previous release.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index' files that accompany GenBank
releases. The GenBank README describes the CON division of GenBank in more
detail:

     ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 135.0 flatfiles require roughly 100 GB (sequence
files only) or 114 GB (including the 'short directory' and 'index' files).
The following table contains the approximate sizes of the individual files in
this release.  Since minor changes to some of the files might have occurred
after these release notes were written, these sizes should not be used to
determine file integrity; they are provided as an aid to planning only.

File Size      File Name

 250008056     gbbct1.seq
 250340813     gbbct2.seq
 250000317     gbbct3.seq
 250111246     gbbct4.seq
 250007321     gbbct5.seq
 250002635     gbbct6.seq
  52586799     gbbct7.seq
   4903037     gbchg.txt
    357869     gbdel.txt
 230687980     gbest1.seq
 230688724     gbest10.seq
 230688834     gbest100.seq
 230691114     gbest101.seq
 230689970     gbest102.seq
 230689348     gbest103.seq
 230689697     gbest104.seq
 230690100     gbest105.seq
 230689984     gbest106.seq
 230688549     gbest107.seq
 230689245     gbest108.seq
 230689805     gbest109.seq
 230689156     gbest11.seq
 230689606     gbest110.seq
 230690293     gbest111.seq
 230689413     gbest112.seq
 230690499     gbest113.seq
 230688130     gbest114.seq
 230688562     gbest115.seq
 230687843     gbest116.seq
 230687655     gbest117.seq
 230688453     gbest118.seq
 230689264     gbest119.seq
 230690674     gbest12.seq
 230689725     gbest120.seq
 230687475     gbest121.seq
 230687880     gbest122.seq
 230690252     gbest123.seq
 230689718     gbest124.seq
 230688282     gbest125.seq
 230688955     gbest126.seq
 230689752     gbest127.seq
 230689280     gbest128.seq
 230688721     gbest129.seq
 230689435     gbest13.seq
 230688811     gbest130.seq
 230689562     gbest131.seq
 230687881     gbest132.seq
 230689053     gbest133.seq
 230690568     gbest134.seq
 230689247     gbest135.seq
 230689633     gbest136.seq
 230688628     gbest137.seq
 230687991     gbest138.seq
 230688879     gbest139.seq
 230688790     gbest14.seq
 230687724     gbest140.seq
 230689607     gbest141.seq
 230688007     gbest142.seq
 230689973     gbest143.seq
 230690066     gbest144.seq
 230688783     gbest145.seq
 230687636     gbest146.seq
 230690183     gbest147.seq
 230688367     gbest148.seq
 230687938     gbest149.seq
 230688941     gbest15.seq
 230689420     gbest150.seq
 230688553     gbest151.seq
 230687779     gbest152.seq
 230691636     gbest153.seq
 230690442     gbest154.seq
 230691455     gbest155.seq
 230688374     gbest156.seq
 230689564     gbest157.seq
 230689916     gbest158.seq
 230688646     gbest159.seq
 230688299     gbest16.seq
 230688766     gbest160.seq
 230688193     gbest161.seq
 230690130     gbest162.seq
 230690541     gbest163.seq
 230687560     gbest164.seq
 230688990     gbest165.seq
 230690672     gbest166.seq
 230687965     gbest167.seq
 230688567     gbest168.seq
 230688459     gbest169.seq
 230688340     gbest17.seq
 230688629     gbest170.seq
 230688586     gbest171.seq
 230687578     gbest172.seq
 230690109     gbest173.seq
 230687856     gbest174.seq
 230687938     gbest175.seq
 230689271     gbest176.seq
 230687820     gbest177.seq
 230688363     gbest178.seq
 230690605     gbest179.seq
 230689704     gbest18.seq
 230688098     gbest180.seq
 230689571     gbest181.seq
 230688483     gbest182.seq
 230688219     gbest183.seq
 230687792     gbest184.seq
 230689098     gbest185.seq
 230688559     gbest186.seq
 230688341     gbest187.seq
 230688599     gbest188.seq
 230687832     gbest189.seq
 230689392     gbest19.seq
 191433811     gbest190.seq
 163448723     gbest191.seq
 164567180     gbest192.seq
 171931572     gbest193.seq
 170683582     gbest194.seq
 164553449     gbest195.seq
 165967786     gbest196.seq
 165531023     gbest197.seq
 164870634     gbest198.seq
 165556914     gbest199.seq
 230690391     gbest2.seq
 230690492     gbest20.seq
 164988392     gbest200.seq
 165035087     gbest201.seq
 163782348     gbest202.seq
 168623572     gbest203.seq
 163246448     gbest204.seq
 163922226     gbest205.seq
 168111044     gbest206.seq
 168555718     gbest207.seq
 166623004     gbest208.seq
 166479462     gbest209.seq
 230687476     gbest21.seq
 166039120     gbest210.seq
 165994062     gbest211.seq
 165158556     gbest212.seq
 165110187     gbest213.seq
 165948878     gbest214.seq
 165861414     gbest215.seq
 181088202     gbest216.seq
 173196948     gbest217.seq
 215894609     gbest218.seq
 230689023     gbest219.seq
 230688023     gbest22.seq
 230688338     gbest220.seq
 230690321     gbest221.seq
 230687675     gbest222.seq
 230691397     gbest223.seq
 230689123     gbest224.seq
 230688435     gbest225.seq
 230687461     gbest226.seq
 230687945     gbest227.seq
 230690529     gbest228.seq
 230688056     gbest229.seq
 230689663     gbest23.seq
 230688700     gbest230.seq
 230687654     gbest231.seq
 230690333     gbest232.seq
 230688582     gbest233.seq
 230687984     gbest234.seq
 230687641     gbest235.seq
 230688761     gbest236.seq
 230688639     gbest237.seq
 230688394     gbest238.seq
 230690387     gbest239.seq
 230689145     gbest24.seq
 230688319     gbest240.seq
 230690464     gbest241.seq
 223247528     gbest242.seq
 230688661     gbest243.seq
 229580597     gbest244.seq
 230691318     gbest25.seq
 230690532     gbest26.seq
 230689185     gbest27.seq
 230689325     gbest28.seq
 230687613     gbest29.seq
 230688556     gbest3.seq
 230689038     gbest30.seq
 230687592     gbest31.seq
 230689040     gbest32.seq
 230688498     gbest33.seq
 230688872     gbest34.seq
 230688173     gbest35.seq
 191812762     gbest36.seq
 191089106     gbest37.seq
 205972256     gbest38.seq
 215947882     gbest39.seq
 230689876     gbest4.seq
 216529116     gbest40.seq
 216975664     gbest41.seq
 221949848     gbest42.seq
 230688503     gbest43.seq
 230689313     gbest44.seq
 216817561     gbest45.seq
 230688873     gbest46.seq
 230688153     gbest47.seq
 230689655     gbest48.seq
 230691777     gbest49.seq
 165267638     gbest5.seq
 230688477     gbest50.seq
 230687696     gbest51.seq
 230688647     gbest52.seq
 230690130     gbest53.seq
 230689588     gbest54.seq
 230690287     gbest55.seq
 230689911     gbest56.seq
 230689920     gbest57.seq
 230689464     gbest58.seq
 230687854     gbest59.seq
 180014575     gbest6.seq
 230689102     gbest60.seq
 218210323     gbest61.seq
 209529812     gbest62.seq
 209166704     gbest63.seq
 209116506     gbest64.seq
 209541016     gbest65.seq
 210927787     gbest66.seq
 209389084     gbest67.seq
 208918686     gbest68.seq
 210179833     gbest69.seq
 230687546     gbest7.seq
 210098112     gbest70.seq
 205398071     gbest71.seq
 207796243     gbest72.seq
 207271031     gbest73.seq
 209610222     gbest74.seq
 220526657     gbest75.seq
 230691233     gbest76.seq
 230688461     gbest77.seq
 225719625     gbest78.seq
 215561750     gbest79.seq
 230689635     gbest8.seq
 213300610     gbest80.seq
 224032226     gbest81.seq
 230687440     gbest82.seq
 230689909     gbest83.seq
 230687795     gbest84.seq
 230689919     gbest85.seq
 230687868     gbest86.seq
 230687947     gbest87.seq
 230689172     gbest88.seq
 230689256     gbest89.seq
 230687906     gbest9.seq
 230689805     gbest90.seq
 230688011     gbest91.seq
 230689395     gbest92.seq
 230688880     gbest93.seq
 230688128     gbest94.seq
 230688324     gbest95.seq
 230688363     gbest96.seq
 230689085     gbest97.seq
 230689376     gbest98.seq
 230688059     gbest99.seq
 209716920     gbgss1.seq
 209718305     gbgss10.seq
 209718180     gbgss11.seq
 209718416     gbgss12.seq
 209716260     gbgss13.seq
 209718883     gbgss14.seq
 209717939     gbgss15.seq
 209718767     gbgss16.seq
 209717105     gbgss17.seq
 209718096     gbgss18.seq
 209718985     gbgss19.seq
 209717675     gbgss2.seq
 209716935     gbgss20.seq
 209718576     gbgss21.seq
 209719322     gbgss22.seq
 209717966     gbgss23.seq
 209719408     gbgss24.seq
 209718651     gbgss25.seq
 209717323     gbgss26.seq
 209719456     gbgss27.seq
 209716929     gbgss28.seq
 209716350     gbgss29.seq
 209717368     gbgss3.seq
 209717310     gbgss30.seq
 209716764     gbgss31.seq
 209716465     gbgss32.seq
 209718307     gbgss33.seq
 209717120     gbgss34.seq
 209715977     gbgss35.seq
 209716452     gbgss36.seq
 209717134     gbgss37.seq
 209716195     gbgss38.seq
 209717139     gbgss39.seq
 209717202     gbgss4.seq
 209717500     gbgss40.seq
 209716726     gbgss41.seq
 209716891     gbgss42.seq
 209716980     gbgss43.seq
 209715984     gbgss44.seq
 209717174     gbgss45.seq
 209716335     gbgss46.seq
 209718511     gbgss47.seq
 209718210     gbgss48.seq
 209718668     gbgss49.seq
 209716600     gbgss5.seq
 209717723     gbgss50.seq
 209718035     gbgss51.seq
 209716598     gbgss52.seq
 209716385     gbgss53.seq
 209718139     gbgss54.seq
 209719027     gbgss55.seq
 209718087     gbgss56.seq
 209718163     gbgss57.seq
 209717248     gbgss58.seq
  16761637     gbgss59.seq
 209717310     gbgss6.seq
 250000979     gbgss60.seq
 250001658     gbgss61.seq
 250002510     gbgss62.seq
 250000468     gbgss63.seq
 250001469     gbgss64.seq
 250002608     gbgss65.seq
 250001001     gbgss66.seq
 250002188     gbgss67.seq
 250002151     gbgss68.seq
 250000376     gbgss69.seq
 209716294     gbgss7.seq
 108296036     gbgss70.seq
 209716634     gbgss8.seq
 209717702     gbgss9.seq
 250002972     gbhtc1.seq
 250000035     gbhtc2.seq
 250000047     gbhtc3.seq
  72810660     gbhtc4.seq
 250124391     gbhtg1.seq
 250141702     gbhtg10.seq
 250065160     gbhtg11.seq
 250151996     gbhtg12.seq
 250284315     gbhtg13.seq
 250008859     gbhtg14.seq
 250228689     gbhtg15.seq
 250183613     gbhtg16.seq
 250181730     gbhtg17.seq
 250003050     gbhtg18.seq
 250063265     gbhtg19.seq
 250002252     gbhtg2.seq
 250230970     gbhtg20.seq
 250102694     gbhtg21.seq
 250006157     gbhtg22.seq
 250165240     gbhtg23.seq
 250036162     gbhtg24.seq
 250553067     gbhtg25.seq
 250023408     gbhtg26.seq
 250165358     gbhtg27.seq
 250032145     gbhtg28.seq
 250074856     gbhtg29.seq
 250057937     gbhtg3.seq
 250179734     gbhtg30.seq
 250175261     gbhtg31.seq
 250141745     gbhtg32.seq
 250149622     gbhtg33.seq
 250030598     gbhtg34.seq
 250182563     gbhtg35.seq
 250244624     gbhtg36.seq
 250094833     gbhtg37.seq
 250140012     gbhtg38.seq
 250258326     gbhtg39.seq
 250150481     gbhtg4.seq
 250124017     gbhtg40.seq
 250215295     gbhtg41.seq
 250002642     gbhtg42.seq
 250292435     gbhtg43.seq
 250193221     gbhtg44.seq
 250135232     gbhtg45.seq
 250171894     gbhtg46.seq
 250020468     gbhtg47.seq
 250057780     gbhtg48.seq
 250098248     gbhtg49.seq
 250064896     gbhtg5.seq
 250081386     gbhtg50.seq
 250056005     gbhtg51.seq
 250058498     gbhtg52.seq
 250109054     gbhtg53.seq
 250085158     gbhtg54.seq
 250067711     gbhtg55.seq
 250348527     gbhtg56.seq
 250059651     gbhtg57.seq
 250140895     gbhtg58.seq
 250059656     gbhtg59.seq
 250080913     gbhtg6.seq
 250108995     gbhtg60.seq
 250019908     gbhtg61.seq
  89591466     gbhtg62.seq
 250006267     gbhtg7.seq
 250112106     gbhtg8.seq
 250013149     gbhtg9.seq
 250118265     gbinv1.seq
 250058820     gbinv2.seq
 250001766     gbinv3.seq
 250051421     gbinv4.seq
 250028832     gbinv5.seq
  33388884     gbinv6.seq
 166599068     gbmam.seq
  15573259     gbnew.txt
 250000479     gbpat1.seq
 250000822     gbpat2.seq
 250002364     gbpat3.seq
 250016754     gbpat4.seq
 250000057     gbpat5.seq
 250001224     gbpat6.seq
 250002785     gbpat7.seq
 112395004     gbpat8.seq
  22016571     gbphg.seq
 250098284     gbpln1.seq
 250006718     gbpln2.seq
 250190187     gbpln3.seq
 250000425     gbpln4.seq
 250001062     gbpln5.seq
 250032263     gbpln6.seq
 209839114     gbpln7.seq
 250019676     gbpri1.seq
 250008409     gbpri10.seq
 250205171     gbpri11.seq
 250090001     gbpri12.seq
 250149375     gbpri13.seq
 250002403     gbpri14.seq
 250004010     gbpri15.seq
 250102107     gbpri16.seq
 250056188     gbpri17.seq
 250138643     gbpri18.seq
 250055086     gbpri19.seq
 250064176     gbpri2.seq
 250128242     gbpri20.seq
 250116704     gbpri21.seq
 250032041     gbpri22.seq
 250013553     gbpri23.seq
 250262780     gbpri24.seq
 115285980     gbpri25.seq
 250083502     gbpri3.seq
 250157986     gbpri4.seq
 250016248     gbpri5.seq
 250014484     gbpri6.seq
 250017374     gbpri7.seq
 250059972     gbpri8.seq
 250091367     gbpri9.seq
    142707     gbrel.txt
 250157970     gbrod1.seq
 250085714     gbrod2.seq
 250059797     gbrod3.seq
 250148885     gbrod4.seq
 250121964     gbrod5.seq
 250001760     gbrod6.seq
 152079323     gbrod7.seq
 250002424     gbsts1.seq
 198997531     gbsts2.seq
  37558160     gbsyn.seq
   1460672     gbuna.seq
 250001283     gbvrl1.seq
 250002104     gbvrl2.seq
 123204942     gbvrl3.seq
 250123896     gbvrt1.seq
 245211320     gbvrt2.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each sequence
data file:

Division     Entries    Bases

BCT1         22333      100379900
BCT2         7912       106754176
BCT3         43282      96867044
BCT4         25641      101694411
BCT5         37466      99285347
BCT6         35845      92360953
BCT7         13486      17559924
EST1         68333      26365039
EST10        76750      29944017
EST100       70063      31222696
EST101       65277      31138029
EST102       67351      40481514
EST103       70672      36450075
EST104       70191      45696781
EST105       76103      34426431
EST106       74362      27724701
EST107       75786      25968266
EST108       73394      40792331
EST109       66623      33337644
EST11        75354      28760075
EST110       78892      49350961
EST111       79316      44995238
EST112       72700      45605089
EST113       68975      42444999
EST114       73299      47384282
EST115       68278      44960894
EST116       73456      43946000
EST117       76527      44197686
EST118       72439      49405137
EST119       75716      47698272
EST12        77467      30841318
EST120       73373      47512164
EST121       78428      36186422
EST122       78346      27288568
EST123       80572      49697914
EST124       74893      43050898
EST125       65498      36403756
EST126       72155      36267101
EST127       69600      38481761
EST128       65965      36817825
EST129       71814      43228688
EST13        77187      29183542
EST130       72968      46338306
EST131       68427      39655545
EST132       70371      39606843
EST133       73314      45077870
EST134       67491      39619485
EST135       65580      37464253
EST136       102964     56009823
EST137       81820     46243063
EST138       101801     53323100
EST139       108818     58205102
EST14        78676      31968060
EST140       101801     56059723
EST141       89643      53833035
EST142       69178      37280286
EST143       65948      30643643
EST144       60869      29919648
EST145       57658      29951648
EST146       62507      31024495
EST147       59109      30563636
EST148       78748      56458394
EST149       67646      38794225
EST15        73885      31230008
EST150       75648      49305337
EST151       68085      37456644
EST152       62226      30818734
EST153       64993      40675939
EST154       67867      30684074
EST155       63160      47417204
EST156       76104      41783523
EST157       71885      40027107
EST158       68138      45144724
EST159       65874      37780165
EST16        75563      33234361
EST160       63704      41859132
EST161       67431      31741434
EST162       75467      29693373
EST163       71539      45473602
EST164       82134      41165759
EST165       62111      32362038
EST166       68230      49204021
EST167       71526      46666704
EST168       67954      36367439
EST169       68476      44991962
EST17        83217      34228100
EST170       69770      53931519
EST171       69220      34421854
EST172       71227      41330738
EST173       70290      60296923
EST174       65493      48595950
EST175       63958      46570344
EST176       63481      47053321
EST177       65482      45589182
EST178       65595      48061430
EST179       63644      45749572
EST18        80507      32237375
EST180       64596      39500044
EST181       62701      34191442
EST182       67971      39351891
EST183       82993      48657386
EST184       83390      53972780
EST185       78375      45816507
EST186       105796     65713044
EST187       108123     64812782
EST188       99505      59625124
EST189       69435      37888053
EST19        78796      32293616
EST190       40271      19358255
EST191       27860      10582084
EST192       27672      10253223
EST193       26412      9739040
EST194       26678      8983970
EST195       27669      9946248
EST196       27261      10001350
EST197       27245      9815677
EST198       27384      10345436
EST199       27172      12118608
EST2         75036      28805559
EST20        74368      30186297
EST200       27287      11193785
EST201       27392      10145555
EST202       27680      9285897
EST203       26976      9296738
EST204       27863      11338385
EST205       27804      10844139
EST206       27086      11348178
EST207       26712      12020535
EST208       27135      11328113
EST209       27101      10945536
EST21        73749      34287531
EST210       27093      11591614
EST211       27206      11602031
EST212       27329      11054544
EST213       27324      10868382
EST214       27233      10510588
EST215       27238      11160279
EST216       24526      17461906
EST217       25815      17233488
EST218       81219      31364758
EST219       85966      42881866
EST22        75824      30423198
EST220       72576      42858452
EST221       72587      41928617
EST222       70409      44682463
EST223       55310      27912500
EST224       98776      46977528
EST225       90511      45058905
EST226       71613      39628711
EST227       61273      29293818
EST228       70415      45287613
EST229       71045      34667679
EST23        77270      32345060
EST230       71724      33811145
EST231       73987      45511274
EST232       66111      36836473
EST233       66577      37847961
EST234       85856      45930014
EST235       77786      50665830
EST236       80058      55071683
EST237       98488      40384720
EST238       73291      25848355
EST239       72350      27042723
EST24        75385      33684371
EST240       73972      26211122
EST241       72636      26425416
EST242       78094      26207206
EST243       72337      28984028
EST244       74156      28176770
EST25        72379      30761803
EST26        76165      31651139
EST27        76210      33159444
EST28        104259     49734558
EST29        70990      45436631
EST3         73894      29981502
EST30        82000      56531033
EST31        90879      50643389
EST32        97521      50049068
EST33        99778      46079263
EST34        95035      50555952
EST35        103423     46131628
EST36        69085      19025824
EST37        69388      18420507
EST38        74372      21983801
EST39        43538      12009316
EST4         74402      28251763
EST40        43391      11946196
EST41        43040      11967223
EST42        50932      16209680
EST43        99964      43647940
EST44        94488      45006618
EST45        86206      46047045
EST46        92911      44244538
EST47        107325     56054212
EST48        78955      35986472
EST49        68863      29030635
EST5         48500      15380287
EST50        71707      31952746
EST51        75520      32676575
EST52        73873      30659479
EST53        82308      32220677
EST54        68647      27387220
EST55        63814      29842604
EST56        72636      31854506
EST57        80753      36607612
EST58        74246      30116675
EST59        74268      26321444
EST6         55669      17851521
EST60        87745      40554255
EST61        49655      16543240
EST62        40176      11125416
EST63        40204      11992963
EST64        40509      12496194
EST65        40607      12198024
EST66        40518      13008206
EST67        40580      12683693
EST68        40447      12302944
EST69        40153      12110716
EST7         74567      29348606
EST70        40610      12668216
EST71        41477      11835124
EST72        41250      13071384
EST73        41117      12677221
EST74        41011      13503326
EST75        45674      11905851
EST76        40471      24798195
EST77        41995      22131068
EST78        45822      18797714
EST79        50270      23035829
EST8         76202      30681145
EST80        51819      21556377
EST81        57588      23409206
EST82        75864      31675794
EST83        74750      29041273
EST84        73343      34385606
EST85        77673      45950556
EST86        77228      42669158
EST87        76837      37513300
EST88        76106      41724506
EST89        73098      39640707
EST9         77738      29969805
EST90        72943      30234255
EST91        75180      45574367
EST92        70590      31132813
EST93        77558      49499043
EST94        64264      35081498
EST95        72451      37193672
EST96        74343      44323322
EST97        72569      43396630
EST98        70492      44691475
EST99        74522      36973407
GSS1         83259      35671986
GSS10        66628      34170373
GSS11        68874      40613204
GSS12        62891      31915338
GSS13        65649      34594000
GSS14        69181      36065538
GSS15        65586      29706266
GSS16        64442      29751507
GSS17        71555      41774784
GSS18        65568      33869929
GSS19        60253      27409644
GSS2         83485      35628036
GSS20        52118      27255184
GSS21        52560      26104499
GSS22        53721      23101999
GSS23        57869      33395282
GSS24        58810      30362788
GSS25        52942      25072120
GSS26        60553      39584091
GSS27        64361      27364590
GSS28        54058      22159080
GSS29        55495      27570609
GSS3         81437      38313330
GSS30        66668      31559765
GSS31        55462      32005282
GSS32        85583      38052236
GSS33        69621      36861469
GSS34        67978      38945146
GSS35        64911      41653666
GSS36        73306      35913834
GSS37        70019      37052179
GSS38        67635      36639416
GSS39        85256      54646391
GSS4         74355      38120558
GSS40        85995      57123944
GSS41        80834      42046824
GSS42        85181      52318952
GSS43        77824      34174761
GSS44        77331      30687246
GSS45        74851      46055788
GSS46        74201      52268656
GSS47        69531      48870543
GSS48        66294      43818220
GSS49        66360      43684541
GSS5         71182      38065436
GSS50        72178      40493541
GSS51        73077      37023900
GSS52        81289      57701455
GSS53        79819      66406853
GSS54        79829      41307110
GSS55        84935      58504603
GSS56        79167      51018141
GSS57        72162      41591439
GSS58        79450      43457520
GSS59        6084       2435610
GSS6         70655      35417193
GSS60        86691      65546719
GSS61        83144      62398056
GSS62        94492      38467829
GSS63        103974     64719062
GSS64        88625      60057904
GSS65        74792      62886396
GSS66        68469      57585778
GSS67        67401      62212096
GSS68        61202      54021370
GSS69        110004     55352772
GSS7         70944      35613266
GSS70        41086      18152298
GSS8         71352      36474319
GSS9         68975      34298886
HTC1         27550      44219507
HTC2         25838      58501740
HTC3         66330      73945617
HTC4         31885      22491529
HTG1         1329       190561958
HTG10        1239       189247603
HTG11        1413       187222495
HTG12        994        192046733
HTG13        722        192719814
HTG14        738        192465762
HTG15        723        192603914
HTG16        805        192471494
HTG17        729        192657210
HTG18        867        191686414
HTG19        2079       178750986
HTG2         2494       188144720
HTG20        1059       189721649
HTG21        1181       188660002
HTG22        903        191238336
HTG23        752        192440707
HTG24        963        190774836
HTG25        905        191750769
HTG26        920        191138097
HTG27        826        191787563
HTG28        773        192299915
HTG29        933        191202902
HTG3         2504       187892959
HTG30        866        191715177
HTG31        927        191432563
HTG32        1004       190655977
HTG33        979        190719240
HTG34        977        191014631
HTG35       1013       190626480
HTG36        918        191509014
HTG37        908        192395134
HTG38        1018       190930340
HTG39        943        192002373
HTG4         2570       189889508
HTG40        894        191853261
HTG41        867        192331437
HTG42        840        191878678
HTG43        890        191903599
HTG44        972        191315367
HTG45        967        191497999
HTG46        938        192158265
HTG47        958        191479938
HTG48        1075       190800245
HTG49        1190       189644719
HTG5         1296       188216184
HTG50        1126       190598194
HTG51        1351       189671122
HTG52        1099       191307454
HTG53        1165       190275138
HTG54        1137       190363857
HTG55        1145       191466402
HTG56        1225       191536275
HTG57        1011       193948708
HTG58        1141       191100457
HTG59        1386       194434732
HTG6         1290       187827583
HTG60        1034       194136240
HTG61        1179       192771655
HTG62        373        65747245
HTG7         1251       188040761
HTG8         1280       187774738
HTG9         1208       189224660
INV1         9894       173210990
INV2         1927       165627815
INV3         56390      92509317
INV4         56930      88995664
INV5         37712      107899276
INV6         1446       18433034
MAM          48388      56598112
PAT1         220705     69299651
PAT2         166181     92230177
PAT3         150201     81059309
PAT4         104780     117483058
PAT5         138657     90596286
PAT6         118997     63842585
PAT7         100147     62130981
PAT8         91308      27343708
PHG          2308       8408961
PLN1         20254      138902720
PLN2         62697      97954505
PLN3         58090      96218538
PLN4         19182      134222345
PLN5         59663      70734510
PLN6         50283      100661503
PLN7         36022      88559465
PRI1         13921      154817943
PRI10        1386       174020684
PRI11        1270       175465712
PRI12        1512       175127330
PRI13        1608       178651625
PRI14        19711      154040823
PRI15        43879      112245457
PRI16        5168       170302310
PRI17        1627       180553235
PRI18        1797       181507536
PRI19        2270       188269436
PRI2         1423       173595220
PRI20        1304       185868887
PRI21        33775      121287563
PRI22        16914      162625477
PRI23        49027      118906978
PRI24        36912      126214515
PRI25        29190      42514445
PRI3         1259       181991233
PRI4         1281       177748348
PRI5         1139       173796435
PRI6         1225       179675589
PRI7         1198       176089512
PRI8         1321       167899595
PRI9         1230       177416461
ROD1         6965       178970480
ROD2         1083       195464457
ROD3         24151      153124750
ROD4         1187       194164690
ROD5         1240       192771686
ROD6         27825      136568800
ROD7         39929      51949002
STS1         90110      35004787
STS2         73486      33660824
SYN          8392       14977216
UNA          623        333867
VRL1         72814      63107499
VRL2         74052      63696098
VRL3         34705      35124442
VRT1         58484      96322736
VRT2         43496      119166366

2.2.7 Selected Per-Organism Statistics

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 135.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries      Bases   Species

6574171 9743398611   Homo sapiens
4839873 5815119777   Mus musculus
702180  5565107808   Rattus norvegicus
481072   725258089   Danio rerio
350741   695203285   Drosophila melanogaster
221048   620437677   Oryza sativa (japonica cultivar-group)
730719   402816176   Zea mays
502590   394829161   Arabidopsis thaliana
567863   386355126   Brassica oleracea
13379    326808471   Macaca mulatta
427323   317823422   Gallus gallus
499207   294135749   Ciona intestinalis
390231   223252029   Bos taurus
199302   222094921   Caenorhabditis elegans
418485   207706076   Triticum aestivum
166243   191992299   Pan troglodytes
189208   170811939   Tetraodon nigroviridis
273621   166171916   Xenopus laevis
282062  156196664   Hordeum vulgare subsp. vulgare
186121   154322129   Medicago truncatula

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106  Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and lists of accession numbers,
each of the 481 files of a GenBank release begins with the same header,
except for the first line, which contains the file name, and the sixth line,
which contains the title of the file. The first line of the file contains
the file name in character positions 1 to 9 and the full database name
(Genetic Sequence Data Bank) starting in column 22. The brief names of
the files in this release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 April 2003

                NCBI-GenBank Flat File Release 135.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH   Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key ispresented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term
        LOCUS-name1 Div-code1 Accession1
        LOCUS-name2 Div-code2 Accession2
        LOCUS-name3 Div-code3 Accession3
        ....

  Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :

(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$

When viewed by a file browser such as 'less' or 'more' :

(H+,K+)-ATPASE BETA-SUBUNIT
        RATHKATPB ROD M55655
        MUSATP4B1 ROD M64685
        MUSATP4B2 ROD M64686
        MUSATP4B3 ROD M64687
        MUSATP4B4 ROD M64688
        DOGATPASEB MAM M76486

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....

  Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :

AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$

When viewed by a file browser such as 'less' or 'more' :

AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of therecord. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.

LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION        - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI")assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID       - An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS  - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT   - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE    - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM    - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE  - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED     - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT   - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES  - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT - Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.

ORIGIN    - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

     - The ORIGIN line is followed by sequence data (multiple records).

//   - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN     
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifyingDNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

       http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors endswith a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

     http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at theabove URL.

  The Feature Table specification is also available as a printed
document: `TheDDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports ofthe same sequence, and
provides cross-references to other data collections,as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

     http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html

allele         Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region  Span of the C immunological feature
CAAT_signal    `CAAT box' in eukaryotic promoters
CDS       Sequence coding for amino acids in protein (includes
          stop codon)
conflict  Independent sequence determinations differ
D-loop         Displacement loop
D_segment Span of the D immunological feature
enhancer  Cis-acting enhancer of promoter function
exon      Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
          and downstream control elements, and for which
          a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA      Intervening DNA eliminated by recombination
intron         Transcribed region excised by mRNA splicing
J_region  Span of the J immunological feature
LTR       Long terminal repeat
mat_peptide    Mature peptide coding region (does not include stop codon)
misc_binding   Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature   Region of biological significance that cannot be described
          by any other feature
misc_recomb    Miscellaneous recombination feature
misc_RNA  Miscellaneous transcript feature not defined by other RNA keys
misc_signal    Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base  The indicated base is a modified nucleotide
mRNA      Messenger RNA
mutation Obsolete: see variation feature key
N_region  Span of the N immunological feature
old_sequence   Presented sequence revises a previous version
polyA_signal   Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA  Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer         Primer binding region used with PCR
primer_bind    Non-covalent primer binding site
promoter  A region involved in transcription initiation
protein_bind   Non-covalent protein binding site on DNA or RNA
RBS       Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region  Sequence containing repeated subsequences
repeat_unit    One repeated unit of a repeat_region
rRNA      RibosomalRNA
S_region  Span of the S immunological feature
satellite Satellite repeated sequence
scRNA     Small cytoplasmic RNA
sig_peptide    Signal peptide coding region
snRNA     Small nuclear RNA
source         Biological source of the sequence data represented by
          a GenBank record. Mandatory feature, one or more per record.
          For organisms that have been incorporated within the
          NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
          qualifier will be present (where NNNNN is the numeric
          identifier assigned to the organism within the NCBI taxonomy
          database).
stem_loop Hair-pin loop structure in DNA or RNA
STS       Sequence Tagged Site; operationally unique sequence that
          identifies the combination of primer spans used in a PCR assay
TATA_signal    `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA      Transfer RNA
unsure         Authors are unsure about the sequence in this region
V_region  Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip         3'-most region of a precursor transcript removed in processing
3'UTR     3' untranslated region (trailer)
5'clip         5'-most region of a precursor transcript removed in processing
5'UTR     5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon Location of the anticodon of tRNA and the amino acid
          for which it codes

/bound_moiety  Moiety bound

/citation Reference to a citation providing the claim of or
          evidence for a feature

/codon         Specifies a codon that is different from any found in the
          reference genetic code

/codon_start   Indicates the first base of the first complete codon
          in a CDS (as 1 or 2 or 3)

/cons_splice   Identifies intron splice sites that do not conform to
          the 5'-GT... AG-3' splice site consensus

/db_xref  A database cross-reference; pointer to related information
          in another database. A description of all cross-references
          can be found at:

          http://www.ncbi.nlm.nih.gov/collab/db_xref.html

/direction Direction of DNA replication

/EC_number Enzyme Commission number for the enzyme product of the
          sequence

/evidence Value indicating the nature of supporting evidence

/frequency Frequency of the occurrence of a feature

/function Function attributed to a sequence

/gene     Symbol of the gene corresponding to a sequence region (usable
          with all features)

/label         A label used to permanently identify a feature

/map      Map position of the feature in free-format text

/mod_base Abbreviation for a modified nucleotide base

/note     Any comment or additional information

/number        A number indicating the order of genetic elements
          (e.g., exons or introns) in the 5 to 3 direction

/organism Name of the organism that is the source of the
          sequence data in the record.

/partial  Differentiates between complete regions and partial ones

/phenotype Phenotype conferred by the feature

/product  Name of a product encoded by a coding region (CDS)
          feature

/pseudo        Indicates that this feature is a non-functional
          version of the element named by the feature key

/rpt_family    Type of repeated sequence; Alu or Kpn, for example

/rpt_type Organization of repeated sequence

/rpt_unit Identity of repeat unit that constitutes a repeat_region

/standard_name Accepted standard name for this feature

/transl_except Translational exception: single codon, the translation
          of which does not conform to the reference genetic code

/translation   Amino acid translation of a coding region

/type     Name of a strain if different from that in the SOURCE field

/usedin        Indicatesthat feature is used in a compound feature
          in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A.,
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

     ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:

     ftp://genbank.sdsc.edu/pub
     ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

      http://www.ncbi.nlm.nih.gov/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

     ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 135.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination  
     Mark Cavanaugh

GenBankSubmission Coordination    
     Ilene Mizrachi

GenBank Annotation Staff
        Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark, Irene Fang,
     Michael Fetchko, Anjanette Johnston, Pierre Ledoux, Richard McVeigh,
     Leonie Misquitta, Ilene Mizrachi, DeAnne Olsen Cravaritis, 
        Chris O'Sullivan, David Rasko, Leigh Riley, Gert Roosen, Susan
        Schafer, Suh-suh Wang, Jane Weisemann, Steven Wilhite, and
        Linda Yankie

Data Management and Preparation
     Vladimir Alekseyev, Serge Bazhin, Anton Butanaev, Mark Cavanaugh,
     Hsiu-Chuan Chen, Jonathan Kans, Michael Kimelman, Jim Ostell,
     Karl Sirotkin, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
     Tatiana Tatusov, Carolyn Tolstoshev, Jane Weisemann, Eugene Yaschenko

Database Administration
     Helen Epting, Slava Khotomliansky, Tony Stearman

User Support
     Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
     Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris, Vyvy Pham,
     Monica Romiti, Eric Sayers, Tao Tao, David Wheeler

Project Direction
     David Lipman


Acknowledgments -

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241